S10A3_MOUSE P62818
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62818
Recommended name：Protein S100-A3
EC number：
Alternative names：(Protein S-100E) (S100 calcium-binding protein A3)
Cleaved into：
GeneID：20197
Gene names (primary )：S100a3
Gene names (synonym )：
Gene names (ORF )：
Length：101
Mass：11747
Sequence：MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ
Tissue specificity：Skin specific, specifically expressed in cuticle of pelage follicle. {ECO:0000269|PubMed:9804353}.
Induction：
Developmental stage：
Protein families：S-100 family