S10A5_MOUSE   P63084


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63084

Recommended name:Protein S100-A5

EC number:

Alternative names:(Protein S-100D) (S100 calcium-binding protein A5)

Cleaved into:

GeneID:20199

Gene names  (primary ):S100a5

Gene names  (synonym ):S100d

Gene names  (ORF ):

Length:93

Mass:10812

Sequence:METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK

Tissue specificity:

Induction:

Developmental stage:

Protein families:S-100 family


   💬 WhatsApp