SRSF2_MOUSE   Q62093


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62093

Recommended name:Serine/arginine-rich splicing factor 2

EC number:

Alternative names:(Protein PR264) (Putative myelin regulatory factor 1) (MRF-1) (Splicing component, 35 kDa) (Splicing factor SC35) (SC-35) (Splicing factor, arginine/serine-rich 2)

Cleaved into:

GeneID:20382

Gene names  (primary ):Srsf2

Gene names  (synonym ):Pr264 Sfrs10 Sfrs2

Gene names  (ORF ):

Length:221

Mass:25476

Sequence:MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS

Tissue specificity:Expressed in all the tissues examined; liver, kidney, spleen, heart, lung and brain. {ECO:0000269|PubMed:7527040}.

Induction:

Developmental stage:

Protein families:Splicing factor SR family


   💬 WhatsApp