PPM1B_MOUSE   P36993


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P36993

Recommended name:Protein phosphatase 1B

EC number:EC 3.1.3.16

Alternative names:(Protein phosphatase 2C isoform beta) (PP2C-beta)

Cleaved into:

GeneID:19043

Gene names  (primary ):Ppm1b

Gene names  (synonym ):Pp2c2 Pppm1b

Gene names  (ORF ):

Length:390

Mass:42795

Sequence:MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKDNDGGAGDLEDSLVAL

Tissue specificity:Isoform 1: Expressed ubiquitously. Isoform 2: Expressed exclusively in testis and intestine. Isoform 3: Expressed exclusively in brain and intestine. Isoform 4: Expressed exclusively in testis and intestine.

Induction:

Developmental stage:

Protein families:PP2C family


   💬 WhatsApp