CANB2_MOUSE   Q63811


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63811

Recommended name:Calcineurin subunit B type 2

EC number:

Alternative names:(Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B beta isoform)

Cleaved into:

GeneID:19059

Gene names  (primary ):Ppp3r2

Gene names  (synonym ):

Gene names  (ORF ):

Length:179

Mass:20659

Sequence:MGNEASYQTELCNHFDQEEIRRLGKSFRKLDLDKSGSLSIEEFMRLPELQQNPLVGRVIDIFDTDGNGEVDFHEFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMVGNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVVKTMEIHKKLVVFVEHGQEDLKA

Tissue specificity:Testis specific. {ECO:0000269|PubMed:1325794}.

Induction:

Developmental stage:

Protein families:Calcineurin regulatory subunit family


   💬 WhatsApp