PPM1L_MOUSE   Q8BHN0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BHN0

Recommended name:Protein phosphatase 1L

EC number:EC 3.1.3.16

Alternative names:(Protein phosphatase 1-like) (Protein phosphatase 2C isoform epsilon) (PP2C-epsilon)

Cleaved into:

GeneID:242083

Gene names  (primary ):Ppm1l

Gene names  (synonym ):Kiaa4175

Gene names  (ORF ):

Length:360

Mass:41049

Sequence:MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKSHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLTYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEH

Tissue specificity:Expressed in brain, heart, testis, liver, lung and skeletal muscle. {ECO:0000269|PubMed:12556533}.

Induction:

Developmental stage:

Protein families:PP2C family


   💬 WhatsApp