PPR3C_MOUSE   Q7TMB3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TMB3

Recommended name:Protein phosphatase 1 regulatory subunit 3C

EC number:

Alternative names:(Protein phosphatase 1 regulatory subunit 5) (PP1 subunit R5) (Protein targeting to glycogen) (PTG)

Cleaved into:

GeneID:53412

Gene names  (primary ):Ppp1r3c

Gene names  (synonym ):Ppp1r5

Gene names  (ORF ):

Length:317

Mass:36460

Sequence:MSCTRMIHVLDPRPLTSSVMPVDMAMRICLAHSPPLKSFLGPYNGFQRRNFVNKLKPLKPCLSVKQEAKSQSEWKSPHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSSLKLHEEKNLVFDFPQPSTDYLSFRDRFQKNFVCLENCSLQDRTVTGTVKVKNVSFEKKVQVRITFDTWKTYTDVDCVYMKNVYSSSDSDTFSFAIDLPRVIPTEEKIEFCISYHANGRIFWDNNEGQNYRIVHVQWKPDGVQTQVAPKDCAFQQGPPKTEIEPTVFGSPRLASGLFPEWQSWGRVENLTSYR

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp