LRC51_MOUSE   Q9DAK8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAK8

Recommended name:Leucine-rich repeat-containing protein 51

EC number:

Alternative names:(Protein LRTOMT1)

Cleaved into:

GeneID:69358

Gene names  (primary ):Lrrc51

Gene names  (synonym ):Lrtomt1

Gene names  (ORF ):

Length:192

Mass:22008

Sequence:MSSRDYMNTSVQEPPLDYSFKSVQMVQDLVTEEPRTGLRPVRHSKSGKSLTQSLWLNNNVLNDLKDFNQVVSQLLQHPENLAWIDLSFNDLTTIDPVLTTFFNLSVLYLHGNGIHRLGEVNKLAVLPRLRSLTLHGNPIEEEKGYRQYVLCNLPRITTFDFSGVTRADRSTAEVWKRMGIKPKKVRAKQDVL

Tissue specificity:Widely expressed in adult and embryonic tissues. Expressed in the developing choroid plexus from E12.5 and in the epithelium of the developing airway tract from E14.5. Also expressed in the postnatal inner ear. {ECO:0000269|PubMed:18953341}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp