T255B_MOUSE   Q5FW56


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5FW56

Recommended name:Transmembrane protein 255B

EC number:

Alternative names:(Protein FAM70B)

Cleaved into:

GeneID:272465

Gene names  (primary ):Tmem255b

Gene names  (synonym ):Fam70b Gm687

Gene names  (ORF ):

Length:369

Mass:39392

Sequence:MVGAEGRWREKGNDQRRGRKKRGGVEESGHRAAFLETAGTLKPNHRAGGASGHCPPSGGHFGNAAAPTARARPSGSAGHHRGLCQEEEDLSVVCGLSPAGVYSHPDHWPCCNHQDRECDCGRLLPRDYFAASIVFLSFGVVAAFCCAIVDSVFAARHIEPRPLSAGRCQFYSSGAGYLYDVYQTEVTCYSLNGRCQLKVRSNTCYCCDLYACGSTEPSPAYYEFVGVRSCQDVVHLYRLLWVSTVLNVLGLCLGIVTAAVLGAFKDMVPLSQLAYGPSPPPQILYNPAQQILAYTGLCPPSMGVPTCSSYPLPLQPSSAPPASASADLSLPEDTESPSQCQPSRGCSHAPSPCTPAYFLPGEKPPPYAP

Tissue specificity:

Induction:

Developmental stage:

Protein families:TMEM255 family


   💬 WhatsApp