DIK1A_MOUSE   Q9D6I7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D6I7

Recommended name:Divergent protein kinase domain 1A

EC number:

Alternative names:(Protein FAM69A)

Cleaved into:

GeneID:67266

Gene names  (primary ):Dipk1a

Gene names  (synonym ):Fam69a

Gene names  (ORF ):

Length:428

Mass:48936

Sequence:MARSLCAGAWLRKPHYLQARLSYMRVKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCKKIICDKYKTGVIDGPACNSLCVTETLYFGKCLSNKPSNQMYLGVWDNLPGVVKCQMEQALHLDFGTELEPRKEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADGDRDGQVSLGEAKSAWALLQLNEFLLMVILQDKEHTPKLMGFCGDLYVMESVEYTSLYGISLPWVMELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNLGYNEKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDLSTMKCTSEVIQPNLAKACQLLKDYLLHGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWKKISYTNDS

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:21334309}.

Induction:

Developmental stage:

Protein families:DIPK family


   💬 WhatsApp