RAMAC_MOUSE Q9CQY2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQY2
Recommended name：RNA guanine-N7 methyltransferase activating subunit
EC number：
Alternative names：(Protein FAM103A1) (RNA guanine-7 methyltransferase activating subunit) (RNMT-activating mRNA cap methylating subunit) (RNMT-activating mRNA cap methyltransferase subunit) (RNMT-activating mini protein) (RAM)
Cleaved into：
GeneID：67148
Gene names (primary )：Ramac
Gene names (synonym )：Fam103a1 Rammet
Gene names (ORF )：
Length：119
Mass：14556
Sequence：MSDTSEEIPNFEEMFASRFTKDDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNWLQDNRQFRGRDNRRGWPSDNRSNQWHGRSWGNNNYPQQRPEPYYQQQYTQYGHNQRPPYGYY
Tissue specificity：
Induction：
Developmental stage：
Protein families：RAM family