STAR3_MOUSE   Q61542


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61542

Recommended name:StAR-related lipid transfer protein 3

EC number:

Alternative names:(Protein ES 64) (Protein MLN 64) (START domain-containing protein 3) (StARD3)

Cleaved into:

GeneID:59045

Gene names  (primary ):Stard3

Gene names  (synonym ):Es64 Mln64

Gene names  (ORF ):

Length:446

Mass:50470

Sequence:MSKRPGDLACDLERSLPALASLGTSLSHSQSLSSHFIPPPLEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEVIHYSFQSSFFDIFVLAFFRFSGLLLGYAVLRLQHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQAAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVTGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFERSNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLVSYDVSSGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATTHCSKPPTHKYVRGENGPGGFIVLKSANNPRVCTFVWILNTDLKGRLPRYLIHQSLGATMFEFAFHLRQRVGELGARA

Tissue specificity:

Induction:

Developmental stage:

Protein families:STARD3 family


   💬 WhatsApp