LST1_MOUSE   O08843


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O08843

Recommended name:Leukocyte-specific transcript 1 protein

EC number:

Alternative names:(Protein B144)

Cleaved into:

GeneID:

Gene names  (primary ):Lst1

Gene names  (synonym ):B144

Gene names  (ORF ):

Length:95

Mass:10325

Sequence:MSDDNGSGNNCTTNHFLLYGSLGLGGLLLLLVIILFICLCGFSQRVKRLERNAQVSGQEPHYASLQQLPVSSSDITDMKEDLSTDYACIARSTPT

Tissue specificity:Expressed in spleen and at lower levels in thymus and liver. {ECO:0000269|PubMed:11478849}.

Induction:

Developmental stage:

Protein families:LST1 family


   💬 WhatsApp