SBDS_MOUSE   P70122


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70122

Recommended name:Ribosome maturation protein SBDS

EC number:

Alternative names:(Protein 22A3) (Shwachman-Bodian-Diamond syndrome protein homolog)

Cleaved into:

GeneID:66711

Gene names  (primary ):Sbds

Gene names  (synonym ):

Gene names  (ORF ):

Length:250

Mass:28781

Sequence:MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE

Tissue specificity:Detected in adult liver, brain, heart, spleen, pancreas, kidney, lung and testis (at protein level). Detected in heart, brain, lung, liver, kidney and testis. {ECO:0000269|PubMed:16914746}.

Induction:

Developmental stage:

Protein families:SDO1/SBDS family


   💬 WhatsApp