SPDEF_MOUSE Q9WTP3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTP3
Recommended name:SAM pointed domain-containing Ets transcription factor
EC number:
Alternative names:(Prostate epithelium-specific Ets transcription factor) (Prostate-specific Ets) (Prostate-derived Ets factor)
Cleaved into:
GeneID:30051
Gene names (primary ):Spdef
Gene names (synonym ):Pdef Pse
Gene names (ORF ):
Length:325
Mass:36356
Sequence:MGSASPGLSNVSPGCLLLFPDVAPRTGTEKAASGAMGPEKQEWSPSPPATPEQGLSAFYLSYFNMYPDDSSWVAKVPEARAGEDHPEEPEQCPVIDSQASGSTLDEHSLEQVQSMVVGEVLKDIETACKLLNITADPGDWSPGNVQKWLLWTEHQYRLPPAGKAFQELGGKELCAMSEEQFRQRAPLGGDVLHAHLDIWKSAAWMKERTSPGTLHYCASTSEEGWTDGEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGVRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPV
Tissue specificity:Expressed in the accessory glands of sex organs including the prostate, seminal vesicle, coagulating gland in males, the oviduct in females, and in intestines. Expression is epithelial-specific. {ECO:0000269|PubMed:10675039}.
Induction:
Developmental stage:
Protein families:ETS family