S45A3_MOUSE   Q8K0H7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K0H7

Recommended name:Solute carrier family 45 member 3

EC number:

Alternative names:(Prostate cancer-associated protein 6) (Prostein)

Cleaved into:

GeneID:212980

Gene names  (primary ):Slc45a3

Gene names  (synonym ):Pcanap6 Prst

Gene names  (ORF ):

Length:553

Mass:59742

Sequence:MIQRLWASRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIGPVLGLVSVPLLGSASDQWRGRYGRRRPFIWALSLGVLLSLFLIPRAGWLAGLLYPDTRPLELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAFSVYAFMISLGGCLGYLLPAIDWDTSVLAPYLGTQEECLFGLLTLIFLICMAATLFVTEEAVLGPPEPAEGLLVSAVSRRCCPCHVGLAFRNLGTLFPRLQQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGLYQGVPRAEPGTEARRHYDEGIRMGSLGLFLQCAISLVFSLVMDRLVQKFGTRSVYLASVMTFPVAAAATCLSHSVVVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDAGGSSGEDSQTTSFLPGPKPGALFPNGHVGSGSSGILAPPPALCGASACDVSMRVVVGEPPEARVVTGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSHSVTAYMVSAAGLGLVAIYFATQVVFDKNDLAKYSV

Tissue specificity:Expressed in the epididymis. {ECO:0000269|PubMed:14561649}.

Induction:

Developmental stage:

Protein families:Glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family


   💬 WhatsApp