PRCD_MOUSE   Q00LT2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00LT2

Recommended name:Photoreceptor disk component PRCD

EC number:

Alternative names:(Progressive rod-cone degeneration protein homolog)

Cleaved into:

GeneID:100038570

Gene names  (primary ):Prcd

Gene names  (synonym ):Gm11744

Gene names  (ORF ):

Length:53

Mass:5931

Sequence:MCTTLFLFSLAMLWRRRFTNRVEPEPSRVDGTVVGSGSDTDLQSTGREKGPVK

Tissue specificity:Expressed in retina, where it localizes to both rod and cone photoreceptors (at protein level). {ECO:0000269|PubMed:23672200, ECO:0000269|PubMed:27509380, ECO:0000269|PubMed:27613864}.

Induction:

Developmental stage:

Protein families:PRCD family


   💬 WhatsApp