PAQR2_MOUSE   Q8BQS5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BQS5

Recommended name:Adiponectin receptor protein 2

EC number:

Alternative names:(Progestin and adipoQ receptor family member 2) (Progestin and adipoQ receptor family member II)

Cleaved into:

GeneID:68465

Gene names  (primary ):Adipor2

Gene names  (synonym ):D6Ucla1e Parq2

Gene names  (ORF ):

Length:386

Mass:43981

Sequence:MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPSLETPVCSSYYENSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCTEEDAL

Tissue specificity:Detected in liver and quadriceps muscle (at protein level) (PubMed:17327425). Highly expressed in liver (PubMed:12802337). Highly expressed in white adipose tissue, and at intermediate levels in brown adipose tissue (PubMed:24742672). Expressed at intermediate level in heart, kidney, lung and skeletal muscle. Weakly expressed in brain, spleen and testis. {ECO:0000269|PubMed:12802337, ECO:0000269|PubMed:17327425, ECO:0000269|PubMed:24742672}.

Induction:

Developmental stage:

Protein families:ADIPOR family


   💬 WhatsApp