PAQR1_MOUSE Q91VH1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91VH1
Recommended name：Adiponectin receptor protein 1
EC number：
Alternative names：(Progestin and adipoQ receptor family member 1) (Progestin and adipoQ receptor family member I)
Cleaved into：
GeneID：72674
Gene names (primary )：Adipor1
Gene names (synonym )：Parq1
Gene names (ORF )：
Length：375
Mass：42366
Sequence：MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSPAKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL
Tissue specificity：Detected in brain and quadriceps muscle (at protein level) (PubMed:17327425). Widely expressed (PubMed:12802337). Expressed in heart, kidney, liver, lung, skeletal muscle, white adipose tissue, brown adipose tissue, aorta and spleen (PubMed:12802337, PubMed:24742672). Weakly expressed in brain and testis (PubMed:12802337). {ECO:0000269|PubMed:12802337, ECO:0000269|PubMed:17268472, ECO:0000269|PubMed:17327425, ECO:0000269|PubMed:24742672}.
Induction：
Developmental stage：
Protein families：ADIPOR family