TKN4_MOUSE Q99N14
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99N14
Recommended name：Tachykinin-4
EC number：
Alternative names：(Preprotachykinin-C) (PPT-C)
Cleaved into：Hemokinin (HK1) (Hemokinin-1) (Hemokinin-I) (HK-I)
GeneID：93670
Gene names (primary )：Tac4
Gene names (synonym )：
Gene names (ORF )：
Length：128
Mass：13937
Sequence：MLPLLALLLLIGPSVCTTAGDREELAFGAEAESWVTVNLKGIPVPSIELKLQELKRSRTRQFYGLMGKRVGGYQLGRIVQDLLGTRGLSIEGTCRQAASQQRARPGAVTRESLQSREEDEAPLTTSNV
Tissue specificity：Expressed in hematopoietic cells with highest levels in pre- and pro-B cells but not in later developmental stages. Also detected in uterus, skeletal muscle, brain, spleen, stomach, skin and lactating mammary gland and in cells of myeloid lineage including dendritic and microglial cells and macrophages. In uterus, highest expression is observed in non-pregnant diestrus mice and in day 5 pregnant mice. Compared with mice in diestrus, decreases 2.6-fold in uteri from non-pregnant mice in estrus and 10.2-fold in day 17 pregnant mice. Detected at sites of chronic inflammation such as granulomas. {ECO:0000269|PubMed:11062498, ECO:0000269|PubMed:12383518, ECO:0000269|PubMed:12716968, ECO:0000269|PubMed:12842130, ECO:0000269|PubMed:15153465, ECO:0000269|PubMed:15342200, ECO:0000269|PubMed:15647454}.
Induction：
Developmental stage：
Protein families：Tachykinin family