PRAP1_MOUSE Q80XD8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80XD8
Recommended name：Proline-rich acidic protein 1
EC number：
Alternative names：(Pregnancy-specific uterine protein) (Uterine-specific proline-rich acidic protein)
Cleaved into：
GeneID：22264
Gene names (primary )：Prap1
Gene names (synonym )：Upa
Gene names (ORF )：
Length：149
Mass：16798
Sequence：MKRFLLATCLVAALLWEAGAAPAHQVPVKTKGKHVFPEQETEKVWDTRALEPLEKDNQLGPLLPEPKQKPAAAEEKRPDAMTWVETEDILSHLRSPLQGPELDLDSIDHPMSDDVQDEEVPQSRPILYRQVLQGPEEDLDHLAHSMEDS
Tissue specificity：Abundantly expressed in the uterus during late pregnancy by uterus epithelial cells. After birth expression rapidly decreases and is no longer found in the uterus by the third day. Also highly expressed in the small intestine where it shows a proximal-distal graded expression. {ECO:0000269|PubMed:10899595, ECO:0000269|PubMed:9065197}.
Induction：
Developmental stage：
Protein families：