S66A3_MOUSE   Q8C6U2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C6U2

Recommended name:Solute carrier family 66 member 3

EC number:

Alternative names:(PQ-loop repeat-containing protein 3)

Cleaved into:

GeneID:217430

Gene names  (primary ):Slc66a3

Gene names  (synonym ):Pqlc3

Gene names  (ORF ):

Length:202

Mass:22739

Sequence:MEAGLLWFCNWSTLGVCAALKLPQIYAQLAARSARGISLPSLLLELAGFLVFLRYQHYYGNPLLTYLEYPILIAQDIVLLLFVFHFNGNVKQALPYMAVFVSSWFILSLQKWIIDLAMNLCTVISAASKFAQLQYLWKVQDSGAVSALTWGLSAYTCATRIITTLMTTNDLTILIRFVIMLALNIWVTATVLHYRKSATKAE

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp