PQBP1_MOUSE Q91VJ5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91VJ5
Recommended name：Polyglutamine-binding protein 1
EC number：
Alternative names：(PQBP-1) (38 kDa nuclear protein containing a WW domain) (Npw38) (Polyglutamine tract-binding protein 1)
Cleaved into：
GeneID：54633
Gene names (primary )：Pqbp1
Gene names (synonym )：Npw38
Gene names (ORF )：
Length：263
Mass：30597
Sequence：MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRIEGLPPSWYKVFDPSCGLPYYWNVETDLVSWLSPHDPNFVVTKSAKKVRNNNADAEDKSDRNLEKVDRNHEKSDRSHEKPDRSHEKADRNHEKNDRERERNYDKVDRERDRDRERERAFDKADREEGKDRRHHRREELAPYPKNKKATSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
Tissue specificity：Detected in brain cortex and hippocampus neurons (at protein level). Expressed in brain with high level in cerebellar cortex, hippocampus and olfactory bulb. {ECO:0000269|PubMed:10332029, ECO:0000269|PubMed:23512658}.
Induction：
Developmental stage：
Protein families：