FKBP5_MOUSE   Q64378


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64378

Recommended name:Peptidyl-prolyl cis-trans isomerase FKBP5

EC number:EC 5.2.1.8

Alternative names:(PPIase FKBP5) (51 kDa FK506-binding protein) (51 kDa FKBP) (FKBP-51) (FK506-binding protein 5) (FKBP-5) (Rotamase)

Cleaved into:

GeneID:14229

Gene names  (primary ):Fkbp5

Gene names  (synonym ):Fkbp51

Gene names  (ORF ):

Length:456

Mass:50966

Sequence:MTTDEGTSNNGENPAATMTEQGEDITTKKDRGVLKIVKRVGTSDEAPMFGDKVYVHYKGMLSDGKKFDSSHDRKKPFAFSLGQGQVIKAWDIGVSTMKKGEICHLLCKPEYAYGSAGHLQKIPSNATLFFEIELLDFKGEDLFEDSGVIRRIKRKGEGYSNPNEGATVKVHLEGCCGGRTFDCRDVVFVVGEGEDHDIPIGIDKALVKMQREEQCILYLGPRYGFGEAGKPKFGIDPNAELMYEVTLKSFEKAKESWEMDTKEKLTQAAIVKEKGTVYFKGGKYTQAVIQYRKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDKALGLDSANEKGLYRRGEAQLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERDAKEEASKAGSKKAVEGAAGKQHESQAMEEGKAKGHV

Tissue specificity:Widely expressed, highest levels found in the liver, skeletal muscle, kidney and thymus. Expression is regulated during adipocyte differentiation. {ECO:0000269|PubMed:7479941}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp