PPIA_MOUSE   P17742


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P17742

Recommended name:Peptidyl-prolyl cis-trans isomerase A

EC number:EC 5.2.1.8

Alternative names:(PPIase A) (Cyclophilin A) (Cyclosporin A-binding protein) (Rotamase A) (SP18)

Cleaved into:Peptidyl-prolyl cis-trans isomerase A, N-terminally processed

GeneID:268373

Gene names  (primary ):Ppia

Gene names  (synonym ):

Gene names  (ORF ):

Length:164

Mass:17971

Sequence:MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL

Tissue specificity:Expressed in the kidney thick ascending limb (at protein level) (PubMed:25967121). Expressed in neurons and motor neurons (at protein level) (PubMed:25678563). Expressed in platelets (PubMed:24429998). {ECO:0000269|PubMed:24429998, ECO:0000269|PubMed:25678563, ECO:0000269|PubMed:25967121}.

Induction:

Developmental stage:

Protein families:Cyclophilin-type PPIase family, PPIase A subfamily


   💬 WhatsApp