RAD18_MOUSE   Q9QXK2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXK2

Recommended name:E3 ubiquitin-protein ligase RAD18

EC number:EC 2.3.2.27

Alternative names:(Postreplication repair protein RAD18) (mRAD18Sc) (RING-type E3 ubiquitin transferase RAD18)

Cleaved into:

GeneID:58186

Gene names  (primary ):Rad18

Gene names  (synonym ):Rad18sc

Gene names  (ORF ):

Length:509

Mass:57412

Sequence:MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYRKKHQNAFQLLVDQAKKGYKKTGRVSQAAAMRTDEPAETLPSMRTDEPAETLPSMRTDEPAETLPLMRADEPAETLPSECIAQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNRNDQNREVSPQQTRRTRASECVEIEPRNKRNKN

Tissue specificity:Expressed in thymus, spleen, brain, and ovary.

Induction:

Developmental stage:

Protein families:RAD18 family


   💬 WhatsApp