PRS53_MOUSE   Q571E5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q571E5

Recommended name:Serine protease 53

EC number:EC 3.4.21.-

Alternative names:(Polyserine protease 3) (Polyserase-3)

Cleaved into:

GeneID:330657

Gene names  (primary ):Prss53

Gene names  (synonym ):

Gene names  (ORF ):

Length:552

Mass:58974

Sequence:MRQSWRPELLIVGAVVVIEGLQAAQRACGQRGPGPPEPQEGNTLPGEWPWQASVRRQGVHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHPTVQTTLCLPQPTYHFPFGASCWATGWDQNTSDVSRTLRNLRLRLISRPTCNCLYNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSKCAQEDTPVLLTDMAVHSSWLQAHVHEAAFLVQAPGVVKMSDENSCVACGSLRSAGPQAGALSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGAGPEEWGLKQLILHGAYTHPEGGYDVAFLLLAQPVTLGPGLRPLCLPYADHHLPDGEHGWVLGLTQKAGINYPQTVPVTVLGPMACSRQHAAPGGTGIPILPGMVCTTVVGEPPHCEGLSGAPLVHEIRGTWFLVGLHSFGDTCQSSAKPAVFAALSAYEDWISNLDWQVYFAEEPEPEAETGSCLVNSSQPASC

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase S1 family


   💬 WhatsApp