GLT10_MOUSE Q6P9S7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6P9S7
Recommended name：Polypeptide N-acetylgalactosaminyltransferase 10
EC number：EC 2.4.1.41
Alternative names：(Polypeptide GalNAc transferase 10) (GalNAc-T10) (pp-GaNTase 10) (Protein-UDP acetylgalactosaminyltransferase 10) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10)
Cleaved into：
GeneID：171212
Gene names (primary )：Galnt10
Gene names (synonym )：
Gene names (ORF )：
Length：603
Mass：69116
Sequence：MRRKEKRLLQAVALALAALVLLPNVGLWALYRERQPDGSPGGLGAAVAPAAVQELHSRQKKTFFLGAEQRLKDWHNKEAIRRDAQRVGYGEQGKPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENFNKN
Tissue specificity：Expressed at higher level than GALNT9. In the developing hindbrain region of E14.5 embryos it accumulates in the rapidly dividing, undifferentiated ventricular zone adjacent to the pons. It also accumulates in the regions immediately rostral and caudal to the dorsal rhombic lips differentiating into the cerebellum. Not expressed in the developing choroid plexus. {ECO:0000269|PubMed:11278534}.
Induction：
Developmental stage：
Protein families：Glycosyltransferase 2 family, GalNAc-T subfamily