NO40_MOUSE   Q9ESX4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ESX4

Recommended name:Nucleolar protein of 40 kDa

EC number:

Alternative names:(pNO40) (Putative S1 RNA-binding domain protein) (PS1D protein) (Zinc finger CCHC domain-containing protein 17)

Cleaved into:

GeneID:619605

Gene names  (primary ):Zcchc17

Gene names  (synonym ):Ps1d

Gene names  (ORF ):Ldc4

Length:241

Mass:27472

Sequence:MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVVIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPEEEEEKEEAKAEGLEKPDPTKNSSRKRKKEKKKKKHRDRKSSDCDSSDSESDTGKKARHSSKDSKATKKKKKKKKHKKKHKE

Tissue specificity:Expressed in liver, brain, heart, kidney testis, stomach, small intestine, skin, thymus, uterus, placenta, spleen, lung and skeletal muscle. {ECO:0000269|PubMed:12202495, ECO:0000269|PubMed:12893261}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp