PR2A1_MOUSE   Q9JHK0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHK0

Recommended name:Prolactin-2A1

EC number:

Alternative names:(Placental prolactin-like protein M) (PLP-M) (PRL-like protein M)

Cleaved into:

GeneID:56635

Gene names  (primary ):Prl2a1

Gene names  (synonym ):Prlpm

Gene names  (ORF ):

Length:228

Mass:25554

Sequence:MQLSVTHPCCRTLILLLVSNLLLWESEAVLPICSVRNGRCFGSFEELLERAVSLSEEISKKAFELFTAFDSQYAQSHQLIVKSLKKCHTSSLDLPKPGSQAMQTHPVTLLKLASKLLRAWQVPLNHLVNNLPSLKNVSPSILSKAKEIEEKSNGLLEGVKSILIQMQNGDTEDENYPGWSGLASLKSETEDIRLFAYYNMIRCEGRDTQKVETALKMVKCKISNENNC

Tissue specificity:Expressed specifically in the placenta. Expression restricted to the junctional zone of the chorioallantoic placenta. {ECO:0000269|PubMed:10856884}.

Induction:

Developmental stage:

Protein families:Somatotropin/prolactin family


   💬 WhatsApp