PLS2_MOUSE   Q9DCW2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DCW2

Recommended name:Phospholipid scramblase 2

EC number:

Alternative names:(PL scramblase 2) (Ca(2+)-dependent phospholipid scramblase 2)

Cleaved into:

GeneID:18828

Gene names  (primary ):Plscr2

Gene names  (synonym ):

Gene names  (ORF ):

Length:307

Mass:34052

Sequence:MEAPRSGTYLPAGYAPQYPPAAVQGPPEHTGRPTFQTNYQVPQSGYPGPQASYTVSTSGHEGYAATRLPIQNNQTIVLANTQWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEGCE

Tissue specificity:Expressed in erythrocyte membranes, blood platelets, blood leukocytes, T- and B-lymphocytes, vascular endothelium, spleen, thymus, prostate, testis, uterus, intestine and colon.

Induction:

Developmental stage:

Protein families:Phospholipid scramblase family


   💬 WhatsApp