IPKB_MOUSE   Q04758


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q04758

Recommended name:cAMP-dependent protein kinase inhibitor beta

EC number:

Alternative names:(PKI-beta) (cAMP-dependent protein kinase inhibitor, testis isoform)

Cleaved into:

GeneID:

Gene names  (primary ):Pkib

Gene names  (synonym ):

Gene names  (ORF ):

Length:92

Mass:9682

Sequence:MGGGTSPEAQQDSVMRTDSSEMTDVESVITSFASSARAGRRNALPDIQSSLATSGSSDLPLKLEALAVKEDAKTKNEEKDQGQPKTPLNEGK

Tissue specificity:

Induction:

Developmental stage:

Protein families:PKI family


   💬 WhatsApp