PI5L1_MOUSE   Q6U7H8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6U7H8

Recommended name:Phosphatidylinositol 4-phosphate 5-kinase-like protein 1

EC number:EC 2.7.1.68

Alternative names:(PI(4)P 5-kinase-like protein 1) (PtdIns(4)P-5-kinase-like protein 1) (Phosphatidylinositol phosphate kinase homolog) (PIPKH)

Cleaved into:

GeneID:227733

Gene names  (primary ):Pip5kl1

Gene names  (synonym ):Pipkh

Gene names  (ORF ):

Length:395

Mass:45293

Sequence:MATPSLRSHEIPAHSQEAGNKSISSGSRRGLLWHLRARQSRVGLFEVGPGHELHRMTRMMQEGLWAATQVSKNNPPTGPTTQKDYLEVMTQVHEEGFELGTLAGPAFARLRKSIGLTEEDYQATLGPGDPYLQFFSTSKSKASFFLTHDQRFFVKTQRRHEVHVLLAHLPRYVEHLQQYPHSLLARLLGVYSLRVAQGKKKYFIIMQCIFYPTSRISERYDIKGCNISRWVDPAPEGSPLVLVLKDLNFQEKTMRLGAQRSWFLRQMELDTAFLREVNVLDYSLLVAIQFLHEDEKGIHHSVFSTFKSIQGVSKSKGTGDQNCRMLPDLPNALHILDGPDQRYFLGLVDMTTVYGFRKRLEHVWKMVRYPGQSVSTVSPAHYARRLCRWAEVHTE

Tissue specificity:Highly expressed in brain and testis, relatively to heart, spleen, lung, liver, skeletal muscle and kidney. {ECO:0000269|PubMed:14701839}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp