PP14B_MOUSE Q62084
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62084
Recommended name：Protein phosphatase 1 regulatory subunit 14B
EC number：
Alternative names：(Phosphatase holoenzyme inhibitor 1) (PHI-1) (Phospholipase C-beta-3 neighbouring gene protein)
Cleaved into：
GeneID：18938
Gene names (primary )：Ppp1r14b
Gene names (synonym )：Png
Gene names (ORF )：
Length：147
Mass：15957
Sequence：MADSGPAGGAALAAPAPGPGSGSTGPRVYFQSPPGAAGEGPGGADDDGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDTRAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK
Tissue specificity：Ubiquitous. Highly expressed in testis. Detected at low levels in the other tissues tested. Highly expressed in cardiac muscle, bladder and aorta (at protein level). {ECO:0000269|PubMed:10606530, ECO:0000269|PubMed:8670283}.
Induction：
Developmental stage：
Protein families：PP1 inhibitor family