GPX4_MOUSE O70325
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70325
Recommended name：Phospholipid hydroperoxide glutathione peroxidase
EC number：EC 1.11.1.12
Alternative names：(PHGPx) (Glutathione peroxidase 4) (GPx-4) (GSHPx-4)
Cleaved into：
GeneID：625249
Gene names (primary )：Gpx4
Gene names (synonym )：
Gene names (ORF )：
Length：197
Mass：22229
Sequence：MSWGRLSRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVCLDKYRGFVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFAAGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDLPCYL
Tissue specificity：Widely expressed with the highest levels in testis, heart, cerebrum, ileum, stomach, liver, jejunum and epididymis (PubMed:17503194). Expressed primarily in testis and sperm midpiece (at protein level) (PubMed:19417079, PubMed:12566075). Expressed in brain (at protein level) (PubMed:22207760, PubMed:12566075). Expressed in heart, liver and kidney (at protein level) (PubMed:12566075). Expressed in retina, especially in inner segments of photoreceptor cells (at protein level) (PubMed:22207760). Isoform Mitochondrial and isoform Cytoplasmic: Highly expressed during embryogenesis, while isoform Nuclear is weakly expressed (PubMed:1668477). Isoform Mitochondrial and isoform Nuclear are down-regulated between E14.5 and E17.5, while isoform Cytoplasmic remains constant (PubMed:1668477). Isoform Nuclear: Mainly expressed in sperm (PubMed:11344099). {ECO:0000269|PubMed:11344099, ECO:0000269|PubMed:12566075, ECO:0000269|PubMed:1668477, ECO:0000269|PubMed:17503194, ECO:0000269|PubMed:19417079, ECO:0000269|PubMed:22207760}.
Induction：
Developmental stage：
Protein families：Glutathione peroxidase family