UNC50_MOUSE Q9CQ61
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQ61
Recommended name：Protein unc-50 homolog
EC number：
Alternative names：(Periodontal ligament-specific protein 22) (PDLs22)
Cleaved into：
GeneID：67387
Gene names (primary )：Unc50
Gene names (synonym )：
Gene names (ORF )：
Length：259
Mass：30429
Sequence：MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLMWFVSNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLMVLYGLSLALGWNFTHTLCSFYKYRVK
Tissue specificity：Highly expressed in periodontal ligament and bone marrow, but not in gingival fibroblasts. {ECO:0000269|PubMed:11302735}.
Induction：
Developmental stage：
Protein families：Unc-50 family