PAI2B_MOUSE   Q91W45


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91W45

Recommended name:Polyadenylate-binding protein-interacting protein 2B

EC number:

Alternative names:(PABP-interacting protein 2B) (PAIP-2B) (Poly(A)-binding protein-interacting protein 2B)

Cleaved into:

GeneID:232164

Gene names  (primary ):Paip2b

Gene names  (synonym ):Kiaa1155

Gene names  (ORF ):

Length:136

Mass:15472

Sequence:MTTLNTGSARISIMNGSSVASTSPSVKCKEDQGLNGHEEKENPFAEYMWMENEEDFNRQVEEELQEQDFLDRCFQEMLDEEDQDWFIPARDLPQAVGHLQQQLNGLSVGDSHESEDILSKSNLNPDAKEFVPGVKY

Tissue specificity:Expressed at very high levels in pancreas, at high levels in testis and at moderately high levels in brain, heart and lung (at protein level). {ECO:0000269|PubMed:16804161}.

Induction:

Developmental stage:

Protein families:PAIP2 family


   💬 WhatsApp