TNFL4_MOUSE   P43488


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P43488

Recommended name:Tumor necrosis factor ligand superfamily member 4

EC number:

Alternative names:(OX40 ligand) (OX40L) (CD antigen CD252)

Cleaved into:

GeneID:22164

Gene names  (primary ):Tnfsf4

Gene names  (synonym ):Ox40l Txgp1l

Gene names  (ORF ):

Length:198

Mass:22255

Sequence:MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tumor necrosis factor family


   💬 WhatsApp