ODF3A_MOUSE Q920N1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920N1
Recommended name:Outer dense fiber protein 3
EC number:
Alternative names:(Outer dense fiber of sperm tails protein 3) (Sperm tail protein SHIPPO 1)
Cleaved into:
GeneID:69287
Gene names (primary ):Odf3
Gene names (synonym ):Shippo1
Gene names (ORF ):Beta390
Length:254
Mass:27650
Sequence:MAEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFVKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYSVNPKILKTGKDLGPAYSILGRYHTKTLLTPGPGDYFPEKSTKYVFDSAPSHSISARTKTFRVDSTPGPAAYMLPVVMGPHTVGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTEVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLNKPCAPTVTFGIKHSDYMTPLVVDVE
Tissue specificity:Testis-specific (at protein level). Expression restricted to the germ cell fraction, absent in somatic cell fractions such as Sertoli and Leydig cells. Expression detected in the third week postpartum (23 days) after haploid germ cells developed, expression increased with age. Expressed in the tails of elongated spermatids sticking out toward the tubular lumen, and in cytoplasmic droplets still attached to the spermatid tail membrane. Expressed in the tails of mature sperm, from the connecting piece proximal to the head, along the middle and principal pieces, down to the distal end piece. {ECO:0000269|PubMed:11870087, ECO:0000269|PubMed:16141072}.
Induction:
Developmental stage:
Protein families:ODF3 family