ORC3_MOUSE   Q9JK30


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JK30

Recommended name:Origin recognition complex subunit 3

EC number:

Alternative names:(Origin recognition complex subunit Latheo)

Cleaved into:

GeneID:50793

Gene names  (primary ):Orc3

Gene names  (synonym ):Orc3l

Gene names  (ORF ):

Length:715

Mass:82342

Sequence:MHTGPRTMATSSVSKGCFVFKPDFKKRKVFVPIEDYFNNEELDSEDSKLRFETYSLLWQRMKSETEQLQEELNENLFDNLVDFLQKSHPEFQKNSRDWGSQMKFREIPTAALILGVNVTDHDVILRSLTETLQNNVTPYVVSLQAKDCPDVKHFLQKFTSQLMDCCVDRHSKEVTSGKALKKTNYSMDSLCSWYSAVTQKADHKVTIKKRTASGHWRSPPVVLILKSMESFTSKVLQDFITISSQHLHEFPLILIFGIATSPVIIHRLLPHSVSSLLCVELFQSLSCEQHLTVVLDKLLLTPQFPFKLSKKALQVLTNIFLYHDFSIQSFIKGIKLSLLEHFYSQPLSVLCCDLSEAKKRVNVFSVSQCENIRRLPSFRRYVENQPLGKQVALLTNETFLKEKTQSLLEDLHVYHINYFLVLRCLHNFTSSLPKYPLGRQIRELYCTCLEKKIWDSEEYKSALQLLRMLAKDELVSILQRCIEVLDSSTEKQLGNTTQKIKDFLTQFQNLDADSKEEEDACGSQPKGLQKTDLYHLQKSLLEMKELRRTKKPTKFEMLRENVMNFIDNLVRDYLLPPESQPLHEVVYFSAANTLREHLNAAPRIALHTALNNPYYYLKNEELEGCIPNTAPDICIAYKLHLECSLLINLVDWAEAFATVVTAAEKMDANSTVSEEMSEVIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC

Tissue specificity:

Induction:

Developmental stage:

Protein families:ORC3 family


   💬 WhatsApp