OTOSP_MOUSE   Q8R448


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R448

Recommended name:Otospiralin

EC number:

Alternative names:(Organ of Corti 10 kDa protein)

Cleaved into:

GeneID:260301

Gene names  (primary ):Otos

Gene names  (synonym ):Ocp10

Gene names  (ORF ):

Length:89

Mass:10185

Sequence:MQACVLWWLALGMLLGIPAGAKPMPEEADPHTQPPAMPYWPFSTSDFWNYVQYFQTQGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED

Tissue specificity:Ear specific.

Induction:

Developmental stage:

Protein families:Otospiralin family


   💬 WhatsApp