ONCO_MOUSE   P51879


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51879

Recommended name:Oncomodulin

EC number:

Alternative names:(OM) (Parvalbumin beta)

Cleaved into:

GeneID:18261

Gene names  (primary ):Ocm

Gene names  (synonym ):

Gene names  (ORF ):

Length:109

Mass:12260

Sequence:MSITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS

Tissue specificity:Found in tumor tissues and not detected in normal tissues.

Induction:

Developmental stage:

Protein families:Parvalbumin family


   💬 WhatsApp