O1013_MOUSE Q7TR96
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TR96
Recommended name:Olfactory receptor 1013
EC number:
Alternative names:(Olfactory receptor 213-2)
Cleaved into:
GeneID:258757
Gene names (primary ):Olfr1013
Gene names (synonym ):Mor213-2
Gene names (ORF ):
Length:305
Mass:34324
Sequence:MDQNNNTVSEFIMLGFTTDPVIQKVLFAVFLVVYTLTLMGNSSLIMLICNDSRLHTPMYFFIGNLSFLDLGLSSVYTPKILETCISEDKSISFAGCVAQFFFSAALDYTECYLLAAMAYDRYVAISKPLLYSQAMSLKLCVCFVVASYVGGFINSVIITKDTFALTFCNDNVIDDFFCDIPPLVKLACGKKKSFQSVLFFLLTSNVIIPIVFILATYLFIIATILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYARPRSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEALNKLLK
Tissue specificity:
Induction:
Developmental stage:
Protein families:G-protein coupled receptor 1 family