O1440_MOUSE Q8VFV4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VFV4
Recommended name:Olfactory receptor 1440
EC number:
Alternative names:(Olfactory receptor 202-4)
Cleaved into:
GeneID:258679
Gene names (primary ):Olfr1440
Gene names (synonym ):Mor215-1
Gene names (ORF ):
Length:315
Mass:34943
Sequence:MPGGRNSTVITKFILVGFSDFPKLKLVLFVIFLGSYLSTVVWNLGLIILIRIDPYLHTPMYFFLSNLSFLDFCYISSTTPKMLSGFFQKSKSISFVGCTMQYFIFSSLGLSECCLLAAMAYDRYAAICNPLLYTAIMSPSLCVHMVVGAYSTGLLGSLIQLCAILQLHFCGPNIINHFFCDLPQLLVLSCSETFPLQVLKFVIAVIFGVASVIVILISYGYIIGTILNISSVEGRSKAFNTCASHLTAVTLFFGSGLFVYMRPSSNSSQGYDKMASVFYTVVIPMLNPLIYSLRNKEIKDALQRCKNKCFSQCHC
Tissue specificity:Localized in the dorsomedial and ventral region of the olfactory bulb. {ECO:0000269|PubMed:24361078}.
Induction:
Developmental stage:
Protein families:G-protein coupled receptor 1 family