OBP1B_MOUSE A2AEP0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A2AEP0
Recommended name：Odorant-binding protein 1b
EC number：
Alternative names：(Odorant-binding protein IB)
Cleaved into：
GeneID：628991
Gene names (primary )：Obp1b
Gene names (synonym )：
Gene names (ORF )：
Length：171
Mass：19394
Sequence：MMVKFLLLALVFGLAHVHAHDHPELQGQWKTTAIMADNIDKIETSGPLELFVREITCDEGCQKMKVTFYVKQNGQCSLTTVTGYKQEDGKTFKNQYEGENNYKLLKATSENLVFYDENVDRASRKTKLLYILGKGEALTHEQKERLTELATQKGIPAGNLRELAHEDTCPE
Tissue specificity：Expressed in nasal mucosa (at protein level) (PubMed:8529023). Specifically detected in septal and lateral nasal glands (PubMed:9661663). {ECO:0000269|PubMed:8529023, ECO:0000269|PubMed:9661663}.
Induction：
Developmental stage：
Protein families：Calycin superfamily, Lipocalin family