OBP1A_MOUSE Q9D3H2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D3H2
Recommended name：Odorant-binding protein 1a
EC number：
Alternative names：(Odorant-binding protein IA)
Cleaved into：
GeneID：18249
Gene names (primary )：Obp1a
Gene names (synonym )：
Gene names (ORF )：
Length：163
Mass：18469
Sequence：MAKFLLLALTFGLAHAAMEGPWKTVAIAADRVDKIERGGELRIYCRSLTCEKECKEMKVTFYVNENGQCSLTTITGYLQEDGKTYKTQFQGNNRYKLVDESPENLTFYSENVDRADRKTKLLFILGHGPLTSEQKEKFAELAEEKGIPAGNIREVLITDYCPE
Tissue specificity：Expressed in nasal mucosa (at protein level) (PubMed:8529023). Specifically detected in septal and lateral nasal glands (PubMed:9661663). {ECO:0000269|PubMed:8529023, ECO:0000269|PubMed:9661663}.
Induction：
Developmental stage：
Protein families：Calycin superfamily, Lipocalin family