OLF15_MOUSE P23275
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23275
Recommended name：Olfactory receptor 15
EC number：
Alternative names：(Odorant receptor OR3) (Olfactory receptor 256-17)
Cleaved into：
GeneID：18312
Gene names (primary )：Olfr15
Gene names (synonym )：Mor256-17
Gene names (ORF )：
Length：312
Mass：34320
Sequence：MEVDSNSSSGSFILMGVSDHPHLEIIFFAVILASYLLTLVGNLTIILLSRLDARLHTPMYFFLSNLSSLDLAFTTSSVPQMLKNLWGPDKTISYGGCVTQLYVFLWLGATECILLVVMAFDRYVAVCRPLHYMTVMNPRLCWGLAAISWLGGLGNSVIQSTFTLQLPFCGHRKVDNFLCEVPAMIKLACGDTSLNEAVLNGVCTFFTVVPVSVILVSYCFIAQAVMKIRSVEGRRKAFNTCVSHLVVVFLFYGSAIYGYLLPAKSSNQSQGKFISLFYSVVTPMVNPLIYTLRNKEVKGALGRLLGKGRGAS
Tissue specificity：Olfactory epithelium. Present in various subcellular compartments of the olfactory sensory neurons, particularly in the axonal processes and neve terminals. {ECO:0000269|PubMed:1384038, ECO:0000269|PubMed:15342743}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family