OLF11_MOUSE Q60890
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60890
Recommended name：Olfactory receptor 11
EC number：
Alternative names：(Odorant receptor M49) (Olfactory receptor 256-11)
Cleaved into：
GeneID：218066
Gene names (primary )：Olfr11
Gene names (synonym )：Mor256-11
Gene names (ORF )：
Length：313
Mass：35459
Sequence：MSWANESITGEFVLLGFSDQPWLEFPLFVVFLTSYIVTIFGNLNIILVSHLDPKLHTPMYFFLTNLSVIDLCYITCTVPQMLVNLRSIRKVISFGGCVVQLFMFLALGATECVLLPVMSFDRFVAICRPLHYSVIMHQRLCLQLAAVSWIIGFGNSVWLSILTLQLPRCGHYVIDHFLCEVPALLKLSCVDVTANEAELFFVSVFFHLTPLSLILTSYAFIARAILKIQSAEGRQKAFGTCSSHLIVVSLFYGTALSVYFLPPSPHSKNRRKMVPLFYGIIAPMLNPLIYTLRNKEVKDAFKRLIKRVFLSKN
Tissue specificity：
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family