OL149_MOUSE Q60888
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60888
Recommended name：Olfactory receptor 149
EC number：
Alternative names：(Odorant receptor M31) (Olfactory receptor 224-8) (Olfactory receptor 7G)
Cleaved into：
GeneID：235256
Gene names (primary )：Olfr149
Gene names (synonym )：Mor224-8 Olfr7
Gene names (ORF )：
Length：311
Mass：35274
Sequence：MKNLSVVTQFILLGIPHTEGVETMLFVLFFSFYIFTLVGNLLILLAIVSSSRLHTPMYFFLCQLSVCDIFFPSVSSPKMLFYLSGNTPAISYAGCVSQLFFYHFLGGTECFLYTVMAYDRFVAICYPLRYSVIMSHRICAFLAMGTAVFGCIHSTFLTTLTFQLPYCGPKDVNYYFCDIPVVMKLACADTSTLEMVGFISVGLMPLSCFFFILTSYSCIVRSILQIRSTEGRHRAFSTCSAHFTAILLFYMPVIFIYLRPTPSPWLDATVQILNNLVTPMLNPLIYSLRNKEVKSSLWTVLHLLCFLPKHL
Tissue specificity：
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family