OL149_MOUSE   Q60888


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q60888

Recommended name:Olfactory receptor 149

EC number:

Alternative names:(Odorant receptor M31) (Olfactory receptor 224-8) (Olfactory receptor 7G)

Cleaved into:

GeneID:235256

Gene names  (primary ):Olfr149

Gene names  (synonym ):Mor224-8 Olfr7

Gene names  (ORF ):

Length:311

Mass:35274

Sequence:MKNLSVVTQFILLGIPHTEGVETMLFVLFFSFYIFTLVGNLLILLAIVSSSRLHTPMYFFLCQLSVCDIFFPSVSSPKMLFYLSGNTPAISYAGCVSQLFFYHFLGGTECFLYTVMAYDRFVAICYPLRYSVIMSHRICAFLAMGTAVFGCIHSTFLTTLTFQLPYCGPKDVNYYFCDIPVVMKLACADTSTLEMVGFISVGLMPLSCFFFILTSYSCIVRSILQIRSTEGRHRAFSTCSAHFTAILLFYMPVIFIYLRPTPSPWLDATVQILNNLVTPMLNPLIYSLRNKEVKSSLWTVLHLLCFLPKHL

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp