OLF13_MOUSE P34984
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P34984
Recommended name：Olfactory receptor 13
EC number：
Alternative names：(Odorant receptor K7) (Olfactory receptor 261-6)
Cleaved into：
GeneID：18310
Gene names (primary )：Olfr13
Gene names (synonym )：Mor261-6
Gene names (ORF )：
Length：310
Mass：34569
Sequence：MGNNMTLITEFILLGFPLSPRMQMLLFALFSLFYAFTLLGNGTIVGLICLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLDPVKPISYAGCMTQTFLFLTFAITECLLLVVMSYDRYVAICHPLRYSAIMSWRVCSTMAVTSWIIGVLLSLIHLVLLLPLPFCVSQKVNHFFCEITAILKLACADTHLNETMVLAGAVSVLVGPFSSIVVSYACILGAILKIQSEEGQRKAFSTCSSHLCVVGLFYGTAIVMYVGPRHGSPKEQKKYLLLFHSLFNPMLNPLIYSLRNSDVKNTLKRVLRTQRAL
Tissue specificity：Olfactory epithelium.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family